SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037908 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037908
Domain Number 1 Region: 1204-1952
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.33e-247
Family Motor proteins 0.000000000669
Further Details:      
 
Domain Number 2 Region: 3314-3423
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000249
Family Second domain of FERM 0.0078
Further Details:      
 
Domain Number 3 Region: 2860-2944
Classification Level Classification E-value
Superfamily SH3-domain 0.000000177
Family SH3-domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037908   Gene: ENSMODG00000014007   Transcript: ENSMODT00000039511
Sequence length 3539
Comment pep:known_by_projection chromosome:BROADO5:6:12305052:12433627:-1 gene:ENSMODG00000014007 transcript:ENSMODT00000039511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPEKPKRSLKGTSRLFMGFRDRTPKISKKGQFRSASHFLWSLNRGPQKTKRKKKAKTVLQ
STSKLMTQMREGKRKKAMKEKKPSFMVIRFPGKRGRGKLKPRAQVLSKASTSINWLTKRF
LIKKAEESGSEQASLDAWLNRSSSRFGSQKLPFPSGADILRREGRLRRFPRGRSLYESGE
TIGFLPFETEEPFQQSGSRKSLYGLEGFQDLGEYYDYYREGDDYYDRQSLHQYEEQEQYR
PPWGYYRSEWPEYGDYYYGYPVRDPYEYYDDEYYDSDYYDHDFYGPGYYDDDFGYGYDDY
APPYAPPFGYSPYSYYEGYEEPSYPYNYYWGPYSPYEEAGYYPIPGGQDAIYPPEVPFPY
PEVPPFDYAWEAPIPSPHNPYAYPMDDIMELEEGEQEEEAGIEQKGYTFKPPSTSFFEQQ
GMEKSATSKLSLIRKFRLFPRPQVKIFGKEKLDVPLPPSLDIPLTTDEQEEEEEEEEDQY
PPVSMPYPPYLHPFYAGFLSPRDRNVQRALSAFRMRRDLGFHRELGRPSPPATSLARFIK
KTLSEKKPIPKYGGSARQKGTGSFRRPPVREAAYKRFGYKLAGMDPDNPATPVTLRKFRG
PTTDNSKSQARPPSSPSPEPSRKSVLISPPPLRKTENPDVSSSLWSFLPNLSVPKQSSPY
DSLQEPPSPQPSLHQAPWAPPGHPVLRPQSSWWSLIEPPSVSSFPEPELNPYPLWRPGTL
GFPASPARGPMPPGDLLGSPRAPRRLPPSPQPSLRSFHGTGVRSPLRPSSPQLSIHSAPP
MIYSPRPRRPPFSPPLGAKGSSRHPSLREPPSPNPSLGRLGPPSPHLGSPPLPPRGGSQR
LPSPPPGRSLRRRSLHLPRKLPRTWNRLSEPPTKAVKPQRHLPLQRSLHRRGPPQPPPGA
WGGDGAVPDIPHRQDSRRSLGRRPPPWLPPPLAPSWDVDLPPIQRPPSPWPGLTGSRRGF
SKRRRPPSSFHRPFFQHGGHPLANPAHPPSPVFREREDDSARVILGRLQDPGPGLASKSC
NEDPTKPEEEEGLEPSLPEPSPASVPEFSPVAMKESKGLRGTFSCPLIAPPRATWPRPRR
WASLPASLAPAGPPGIRDKGERGPSRPGRFAIVMPRVQKMSSFQQASAMPQQPSGRQPAG
PAQGLAKTQKSKWLHVSVSTETFRRWPRAAPETVTHYVSCEMSLRCHAFRGPREKEVQAR
WEQKMHSIRNLPSMRYRVPQEEDGVEDMTQLEDLQESAVLSNLKTRFERNLIYTYIGSIL
VSVNPYRMFNIYGMEQVLQYKGRALGENPPHLFATANLAYTKMLDANHNQCIIISGESGS
GKTEATKLILRYLATMNQKRDILPQIKILEATPLLEAFGNAKTVRNDNSSRFGKFIEIFL
ESGLICGAITSQYLLEKSRIVFQAKNERNYHIFYEMLAGLPAQLKQTFSLQEAETYYYLN
QGGNCEILGKSDEADFQRLLSAMEVLNFSIEDQDSIFRILSSILHLGNVYFEKYETDAQE
IASVVSAREIQVVAELLQISPEGLQKAITFKVTETMREKIYTPLTVESAVDARDAIAKIL
YSVLFGWLIDRINTMVYPQKDTLSIAILDIYGFEDLSFNSFEQLCINYANEYLQYFFNKI
IFQEEQDEYIREQIDWREITFTDNQPCINLICLKPYGILRILDDQSCFPQATDHTFLQKC
HYHHGSNPLYSKPKMPLPEFTIKHYAGKVTYQVRGSPPQACLPTPTYLPLLRNSLRGFFS
LLRVPYIKITVPGPLPTFKVWLLFFNILSLSAGFLGLMLLLSCLFLRCNPLFVRCLKPNH
KKEPDLFEPDVVMAQLRYSGVMETIRIRKEGFPVRIPFQVFIDRYRCLVPLKHDIPATGE
ACVSVLNRLCTVTHRMYCIGVSKLFLKEHLYQLLESMRDRVLHLAVLTLQRCLRGFFIKR
RFRSLRRKIILLQSLSRGYLARKKYRKMKRNLVKFRSLVNMYVSQKQYLRELTKRELMNV
TCLEVPAELAGLLQVVTVYKQANADCVVPVRTPKLQSDPQIALPLDINNYPMVKYVQAHF
KDLAFGMLAEPLQSPLTRLEREHHPEALSIFKLILRFMGDPHLHGAQDNLFGNYIVQKGL
AKAELRDEILVQLANQVWRNPNINNKERGWLLLASCLSGFAPSPRLDKYLLKFVSDHAHN
GFQAVCQHRLIQAMAKAQKGPGAARTFPPTLLEWTVTQKKANMALDVYCFNGDQFSCPVH
SWSTGEDVTGDILKHRGLTDGWRGWTVSLKNGSQWAELAGHDYVLDLISDMELIWDFPSR
SRTHRHVEGSREGQGAAPECRVFGNNWDSDEETPALPRHRGRSIGTTKLPDSESYFRHGE
PLRHSSTALWPSFDAASFREPAAPQKGLDRYLDSLFDPVLAYGNTDLEKPAAISYRMKGG
GQPKSEEEPAGPPRTPQDSVPGLDSSTLALQQAFIQKQAVLLAREMTLQAMALQQQQQPP
PPDPGPSQKPIGADGPLKAKNRSPPAKPVLIYAAPALGDPGGVGFQPKALVSGSPSKPRG
SVPPVKPVATPVRVQEQHSSLRPFSPSPELVRHSILNSEHFPQPTQQIKAIIRQCQQPPR
APDGLRKESGKVFVKKSDPHEEALLILKEQMIHAAPGAQGPRQTVALVKPPLTSASRPPL
GTHPAFHIAVSRAIIPAEDPIQTQLHRQSNETFYAYQGVPWKIYLRKEVFYPKDSFNHPV
LLDLLFRQILHDTFSEACIRISKEERMKMKAIFVQNKLDSLHPVVNESIKRAVISEAREG
WEVYFSRLFPATGSVGTGVQILAVSHIGIKLLRLVKGSWSSGEQLRVLRSYSYTDILFVT
IPSVNMLEFNLAGEKLILFSARAPQVKTMVDDFILELKKDSDYVVAVRNYLPDDLNLLSF
HKGDIIHLQSSEWPERGYNYGYVVRKKVVYLEELKRGTPDFGWKFGAIHGRPGRFPMDLV
QPVAAPDFLQLPAELDMGGPRDQSGRAAAVAVAVASSTVAQEFGRKTEGSLARDISREYG
EEASRQEVCGASLLPSHQYTMLEFAQKYFRDPQRRSMDSFRQKSKKGRESRDVSNMLKFS
KTPIQESLIEFSTSSLNKIATEMFLAVMKFMGDFPMKAQTELDVLRSFLQLCRDPEVLRD
EAYCQVIKQITENTSTKPDSCQRGWRLLHILAAYHKCSDVLRPYLFRFFQDVCRSPGLHF
QGIAKACEQNLQKTFQFGGRSELPSNMELRAILAGRSSKRQLFLLPGGLERHLKIKTCTV
ALDVVSDICLEMGLTRAEAFTEYVIFAITNHGQNVCPLSRRDYILDVASEMEQVDSGYTF
WYRRILWAQPLKFENELYVTMHYSQVLPDYLKGLFNSFPTEQPSEQQRQQVSKLAALQHR
AKDGVYLPSVREAQEYIPPQFYRSMKGQAWLNLVIQHMQQIQALSPHQARAQFLGLLSAC
PMFGSSFFFIQSCSNNTVLAPCILAVNQNGLHFLQKESHELTVKFPLKEIQSTRTQRPTA
GSSYPYVEITLGNLTVQRIMQLQLEQGLELCRVVAAHVESLLCAREKRFTLPPSEITLL
Download sequence
Identical sequences F7ANB1
ENSMODP00000037908 ENSMODP00000037908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]