SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038802 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038802
Domain Number 1 Region: 60-105
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.5e-19
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038802   Gene: ENSMODG00000029615   Transcript: ENSMODT00000041909
Sequence length 343
Comment pep:novel chromosome:BROADO5:3:144941664:144959856:1 gene:ENSMODG00000029615 transcript:ENSMODT00000041909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPPRLLSWQWNFLRPAPQASRQGWEKMEALHHMDSLELHCCLYRDPGVPGMPFERDRLP
AQEVLTFKDVAVDFTREEWHLLSPSQKKLYEEVMLENARNLLSVEGETRPEMKVNPTEMS
PSVEEMDVQRFMSDGPDNFAFKKFFVAPQHSSRIEHHRTHTEEKSSETNQSQRFYAQGQP
CWTSKDPPWRRNLMMQLCGKTFTNTPILLYIRESTLGRNLMNATNVERHSQITPVLLYIR
KSTLVRNLMNANNVERHSIGGTILLYIRESTLGRNLMNATNVERHSVGRTILLYIRESIL
GRNLMNANSVERHSISAPGLFTIRECTLGRNLMNASNVERHSV
Download sequence
Identical sequences K7DZ51
ENSMODP00000038802 ENSMODP00000038802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]