SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039465 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039465
Domain Number 1 Region: 97-192
Classification Level Classification E-value
Superfamily SRCR-like 5.89e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00034
Further Details:      
 
Domain Number 2 Region: 2-88
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000131
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039465   Gene: ENSMODG00000029063   Transcript: ENSMODT00000042571
Sequence length 194
Comment pep:novel chromosome:BROADO5:1:85322535:85329695:-1 gene:ENSMODG00000029063 transcript:ENSMODT00000042571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYTEPANCSWTMKVPPNYLINLGFYNIRFNPENGNCKDYIEITDGADVTKLCESTKKIFV
SSSNELSLRFISFSEPDVSKFSAWYNSFPKDARLKLSNGCSGLVEVFHNNEWGTVCEDGW
HIHNAHVICQQLGCGGAATEPEKGLFGPGYGPISLANVNCKGNELNFWQCQNEGWFGHNC
NHNEDAAVICSGIL
Download sequence
Identical sequences K7E114
ENSMODP00000039465 ENSMODP00000039465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]