SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039673 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039673
Domain Number 1 Region: 191-320
Classification Level Classification E-value
Superfamily SEA domain 2.75e-40
Family SEA domain 0.00041
Further Details:      
 
Domain Number 2 Region: 24-146
Classification Level Classification E-value
Superfamily SEA domain 3.01e-26
Family SEA domain 0.00093
Further Details:      
 
Domain Number 3 Region: 335-401
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.58e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039673   Gene: ENSMODG00000027709   Transcript: ENSMODT00000042779
Sequence length 431
Comment pep:novel chromosome:BROADO5:Un:47287281:47334954:1 gene:ENSMODG00000027709 transcript:ENSMODT00000042779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTANNTSGYKHQMSFPCFTNISWSSCYKTFKLSFTITNMFYTTKMNQKDSRTFKAAEHIL
QILLKVLFGSSKLGSQYCGCSGLSLRSLRNSIATGVDILCTFKKDSSNLVLDKKVVSWEL
TEQLCRRELKHLVIDNDSLIVNGYQHKLPGIRSTKRSEVGVGPVTHIPDHGEPGKIMTSL
TSGLLIRESPVYAIAGRYNWKTFILNFTITNMFYTTKMAQRDSSTFRLPECFLQRMFKVL
FERSSLGSQYCGCNVILLRSMKNGAATGVEVICFYKEVFSVPVLDKKKIYQELSQETNGI
TRLGHYILDKKSLYVDGYNPQMMPPPYTKESVYHHGSRRWRKVYRMNGHLFQSKRFNRRA
YCAQCSERIWCLGRQGYKCIKCKLLVHKGCHIFVPRTCKRHMDLMMPSQETQVEDKNDNV
DLPSEENDGLA
Download sequence
Identical sequences K7E1M2
XP_016282819.1.35504 ENSMODP00000039673 ENSMODP00000039673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]