SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040142 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040142
Domain Number 1 Region: 23-84
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000528
Family Complement control module/SCR domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040142   Gene: ENSMODG00000027688   Transcript: ENSMODT00000043244
Sequence length 280
Comment pep:novel chromosome:BROADO5:8:196142807:196155534:1 gene:ENSMODG00000027688 transcript:ENSMODT00000043244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVGLLENSSHLTCLPGHLSEAQCTNPLPPPFGSYNIVKGSGCSLGSVVDFSCQMGYQLI
GSRMMICLLGDNGTIWSHPEPHCEEVTPRSPSDGYQGAVTVPLISGAIILAISISFIRCC
LQERGLRSSSGANQAMYHQGRMANAGRRAGSAVKVQQKHVVTDGKEQRQREHLPTLLSSI
YPGALTIYDNWGFQRSQEAQPWATVQTLSCEVPVFRPTVLQQDPQSPPPTYIYLLQEPRD
LPSLLPRPHGHTRLPREPEPARPRGSNSGSMEDRAQEAQI
Download sequence
Identical sequences K7E2Z1
ENSMODP00000040142 ENSMODP00000040142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]