SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040351 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040351
Domain Number 1 Region: 228-374
Classification Level Classification E-value
Superfamily PH domain-like 2.4e-38
Family Third domain of FERM 0.00062
Further Details:      
 
Domain Number 2 Region: 126-230
Classification Level Classification E-value
Superfamily Second domain of FERM 3.27e-36
Family Second domain of FERM 0.0000515
Further Details:      
 
Domain Number 3 Region: 41-123
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.31e-24
Family First domain of FERM 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040351   Gene: ENSMODG00000028489   Transcript: ENSMODT00000043457
Sequence length 729
Comment pep:known_by_projection chromosome:BROADO5:4:120696622:120829290:-1 gene:ENSMODG00000028489 transcript:ENSMODT00000043457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSFFRRTLGRRSMRKHAEKERLREAQRAATHIPAAGDAKSIITCRVSLLDGTDVSVDLP
KKAKGQALFDQIMYHLDLIESDYFGLRFMDSAQVAHWLDSTKSIKKQVKIGSPYCLHLRV
KFYSSEPNNLREELTRYLFVLQLKQDILSGKLECPFDTAVQLAAYTLQAELGDYDLAEHG
PDLVSEFRFVPIQTEEMELAIFEKWKEYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKAR
DGNDYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKNKLTLVVVEDDEQGKEQEHTFV
FRLEHPKACKHLWKCAVEHHAFFRLRGPVQKGSNRSGFIRLGSRFRYSGKTEYQTTKTNK
ARRSTSFERRPSKRYSRRTLQMKANATKPDESSLQKNVSTQNNGSQQVRGTRLPVISSIP
SGPILVEIENLPRSPGMSHHDRKCLPLTDLLDDSELLDVTAEKTEGVPGTQGTSVAPEEI
SMAASEPGLKEAIVECGEFSDTSVKLKLLEMENCSSTSSKPNININVNKQEEVVKLTEKC
LNNVIESPGSSSLRIPPDIKSNILKAQVEAVHKVTREDETLSHKNSNVQDNVFSNVLKED
NKVLSPEHTMILTHPNAVEENSILKSATDELDALLSSLTENLIDLAAVPPVSSLSSVTPR
WIVPTRTLSNGISGNEVTPARKEECGDPEGLSLVSQPGPFLVDAVTTSVPGLAEEALRKQ
RKCLLTTEL
Download sequence
Identical sequences K7E3J9
ENSMODP00000040351 ENSMODP00000040351 XP_007494114.1.35504 XP_016289072.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]