SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040792 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040792
Domain Number 1 Region: 8-114
Classification Level Classification E-value
Superfamily SRCR-like 1.19e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 2 Region: 137-171
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000314
Family Spermadhesin, CUB domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040792   Gene: ENSMODG00000028457   Transcript: ENSMODT00000043900
Sequence length 173
Comment pep:novel chromosome:BROADO5:1:84956575:84969058:-1 gene:ENSMODG00000028457 transcript:ENSMODT00000043900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FHHYISLDDWIEVRLVNGPGRCSGRVEVHNQGIWGTVCDDLWDKNGADVVCRQLQCGQSI
SAVRGAHFGAGSGKILLDNVQCIGNESHLGQCHHVGWDAHNCGHQEDAGVICSGDHSSGN
LATVIPLAIPGKINGKSSCGGIISNTSGSIRNPPQHEMHDNITCIWEIKANSS
Download sequence
Identical sequences K7E4U0
ENSMODP00000040792 ENSMODP00000040792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]