SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040995 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040995
Domain Number 1 Region: 393-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.24e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 337-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 282-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.85e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 439-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-20
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 90-136
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.89e-20
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040995   Gene: ENSMODG00000027671   Transcript: ENSMODT00000044105
Sequence length 496
Comment pep:novel chromosome:BROADO5:Un:9612772:9622024:-1 gene:ENSMODG00000027671 transcript:ENSMODT00000044105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSRPSGPVDSWGRGCSHGRGRGWSGLFLFSSELPREKQRSGACPGAAGCGCPHAMRTQR
KSLPSGLPPSEAPQGGLAARGMAPWTPRPPSQGSVAFQDVAVDFTQEEWRLLDHSQKELY
REVMLENVQNLLSVEAETNFEMKEMFTKLNLFVKGHGPQKCMNDDLFDFILRELCDSDIK
VNKNPKSDCEFDETAKKFSQYSVLNQYTKFTSESDCCQDSEYNKCFPEEVGLVQSYEKPH
EMPIYQGNLEGMVFGWGLDLIQYPKCKRVEMVSVSNKGSRCFSQNSELGSHQIIHSGENP
YECKHCGKGFTQRGNLAAHHRIHTGEKPYKCTQCGKAFTQRSHLGVHQRFHTGEKPYECT
QCGKTFTAKNNLAKHQRIHTGEKPYGCKQCGKAFTERGSLAAHQRIHTGEKPYECTQCGK
AFTQRSHLATHQRIHTGEKPYECTQCGKAFTLRGHLAAHQRIHTGEKPYECTQCGKAFTY
WMRLAIHQRIHTGEKP
Download sequence
Identical sequences K7E5E3
ENSMODP00000040995 ENSMODP00000040995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]