SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041013 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041013
Domain Number 1 Region: 76-132
Classification Level Classification E-value
Superfamily WWE domain 0.00000000000000458
Family WWE domain 0.0000458
Further Details:      
 
Domain Number 2 Region: 36-81
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000265
Family RING finger domain, C3HC4 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041013   Gene: ENSMODG00000028181   Transcript: ENSMODT00000044123
Sequence length 132
Comment pep:known_by_projection chromosome:BROADO5:2:399532407:399564623:1 gene:ENSMODG00000028181 transcript:ENSMODT00000044123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAGCGEIDHTINMLPTNKKANESCSNAGPSLTVPECAICLQTCVHPVSLPCKHVFCYLC
VKGASWLGKRCALCRQEIPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGRNGWWQYDER
TSRELEDAFSKG
Download sequence
Identical sequences K7E5G1
ENSMODP00000041013 ENSMODP00000041013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]