SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000090 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000090
Domain Number 1 Region: 475-774
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.33e-102
Family PDEase 0.000000606
Further Details:      
 
Domain Number 2 Region: 368-450
Classification Level Classification E-value
Superfamily GAF domain-like 6.21e-21
Family GAF domain 0.00081
Further Details:      
 
Domain Number 3 Region: 131-262
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000000000556
Family GAF domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000090   Gene: ENSOPRG00000000100   Transcript: ENSOPRT00000000102
Sequence length 780
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1262:3709:310849:-1 gene:ENSOPRG00000000100 transcript:ENSOPRT00000000102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGAGCALASLLLGSDMEDGPSSNASCFRRLTECFLSPSLTDEKVKAYLSLHPQVLDEFVS
ESVSAETVEKWLKRKNNKPEDESTHKEVSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXTKADGFALYFLGECNNSLCVFTPPGLKEDRPRLIPTGPITQGTTISAYA
DERFPRGTGLESGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAW
ASVAIHQVQVCRGLAKQTELNDFLLDVSXXXXXXIIVAIDSLLEHIMXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXEVDLYTGYTTRNILCMPIVSRGSVIGVVQMLNKTSGTAFSKTDENNFKMFAVFC
ALALHCANMYHRIRHSECIYRVTMEKLSYHSICTAEEWQGLMRFTLPARLCKEIELFHFD
IGPFENMWPGIFVYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMY
AILQNSYGLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQ
TVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMCQTGSLNLNN
QSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGLQPIPMMDRDK
WDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETALWISAP
Download sequence
Identical sequences ENSOPRP00000000090 ENSOPRP00000000090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]