SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000211 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000211
Domain Number 1 Region: 4-164
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.61e-58
Family Proteasome subunits 0.000000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000211   Gene: ENSOPRG00000000235   Transcript: ENSOPRT00000000235
Sequence length 254
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2539:5901:62463:1 gene:ENSOPRG00000000235 transcript:ENSOPRT00000000235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLHDERT
VRKICALDDHVCMAFATVFLGLTADARVVINRARVECQSHKLTVEDPVTVEYITRFIATL
KQKYTQSNGRRPFGISALIVGFDDDGIPRLYQTDPSGTYHAWKXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFSAKEIELQVTEIEK
EKEEAEKKKSKKST
Download sequence
Identical sequences ENSOPRP00000000211 ENSOPRP00000000211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]