SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000318 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000318
Domain Number 1 Region: 1-152
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.85e-40
Family Proteasome subunits 0.0000000543
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000318   Gene: ENSOPRG00000000353   Transcript: ENSOPRT00000000351
Sequence length 165
Comment pep:novel genescaffold:pika:GeneScaffold_3745:157982:204313:1 gene:ENSOPRG00000000353 transcript:ENSOPRT00000000351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNY
GGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATL
TRENGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKEKEQKEKDK
Download sequence
Identical sequences ENSOPRP00000000318 ENSOPRP00000000318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]