SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000392 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000392
Domain Number 1 Region: 74-207,243-260
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.37e-27
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0011
Further Details:      
 
Domain Number 2 Region: 356-451
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 3.66e-26
Family Anticodon-binding domain of PheRS 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000392   Gene: ENSOPRG00000000428   Transcript: ENSOPRT00000000429
Sequence length 452
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5234:106019:318626:1 gene:ENSOPRG00000000428 transcript:ENSOPRT00000000429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCPVLGRFARTHAYVVRKAGCICSALQHRAWASKPAASEFSAQGAPGSSVVEVLGKSYP
QDDHTNLTRKVLSKVGRDLHNQRHHPLWLVKERVKEHLYRQYVGRAGTPLFSVYDSLSPV
VTTWQNFDSLLIPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLRAGLNAFVVVGDVYR
RDQIDSQHHPVFHQLEAVRLFSKHELFAGVKDGEDLQLFEQSSRSAHKQETHTLEAVKLV
EFDLKRTLSRLMTHLFGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLSK
YPALMNDIAFWLPSENYEENDFYDLVRTVGGDLVEKVDLTDKFEHPKTHRTSHCYRITYR
HMERTLTHKEVRHVHQAIQEAVVRLLGVEGRF
Download sequence
Identical sequences ENSOPRP00000000392 ENSOPRP00000000392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]