SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000410 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000410
Domain Number 1 Region: 2-181
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.19e-27
Family Rhodopsin-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000410   Gene: ENSOPRG00000000449   Transcript: ENSOPRT00000000447
Sequence length 197
Comment pep:known_by_projection scaffold:pika:scaffold_30290:5:598:1 gene:ENSOPRG00000000449 transcript:ENSOPRT00000000447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAWLLCGLAWALALVLTIPSFLYRSLLEEHFPPKKSCGVNYGPNGEHKEMTVAMMRLVIG
FLLPLLTLSVCYTFLLLRTWSRKATRSAKTLKVVVTVVTCFFILWLPYQVTGTLMALHPS
HSATFKAASKLDRLCVSLAYVNCCINPIIYVVAGKTRIRKSLPSILRHVLTDETLSRDSK
SVTRSTADTTAERCQAV
Download sequence
Identical sequences ENSOPRP00000000410 ENSOPRP00000000410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]