SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000413 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000413
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.85e-51
Family Proteasome subunits 0.0000000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000413   Gene: ENSOPRG00000000450   Transcript: ENSOPRT00000000450
Sequence length 185
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2919:23739:27597:-1 gene:ENSOPRG00000000450 transcript:ENSOPRT00000000450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQ
SHRLDLDPVTAEYLIRYLASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTY
HAWKANAIGRGAKSVREFLEKNYTDEAIDTDDLTIKLVIRALLEVVQSGGKNIELAVMRR
DQPLK
Download sequence
Identical sequences ENSOPRP00000000413 ENSOPRP00000000413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]