SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000494 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000494
Domain Number 1 Region: 447-600
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.05e-53
Family Single strand DNA-binding domain, SSB 0.0000000789
Further Details:      
 
Domain Number 2 Region: 288-402
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.57e-32
Family Single strand DNA-binding domain, SSB 0.00000229
Further Details:      
 
Domain Number 3 Region: 2-103
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.57e-22
Family Single strand DNA-binding domain, SSB 0.0000239
Further Details:      
 
Domain Number 4 Region: 207-280
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.81e-20
Family Single strand DNA-binding domain, SSB 0.0000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000494   Gene: ENSOPRG00000000540   Transcript: ENSOPRT00000000544
Sequence length 604
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2034:41315:105378:1 gene:ENSOPRG00000000540 transcript:ENSOPRT00000000544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AIMQQGDTSIKPILQVIXXXXXXXXXXXXXXXLLMSDGLNSLLSFMLATQLNPPVEKEQL
SSNCICQVNRFLVNMLKDGGRVVILMELEVLKSADEVGVKIGNPVPYNEVHGQQQTVPPA
PAANPPASKPQQQNGSSGMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXKLFSMELVDESGEIRATAFNEQVDKFFPLIEVN
KVYYFSKGTLKIANKQFTAVKNDYEMTFNNDTSVMPCDDGNHLPTVQFTFTGIDALESKS
KDSLVDIIGICKSYEDATKITVKSNNREVAKRDIYLMDMSGKVVTATLWGEDADRFDGSR
QPVLAIKGARVSDFGGRSLSVLSSSTVIMNPDIPEAYKLRGXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXADYFSSVATVVYLRKENCMYQACPNQDCNKKVID
QQNGLYRCEKCDSEFPNFKYRMILSANIADFQENQWVTCFQESAEAILGQNTAYLGELRE
KNEQAFEEVFQNANFRSFMFRIRVKLETYNDESRIKATVMDVKPVDYREHARRLIMNIRK
NAVM
Download sequence
Identical sequences ENSOPRP00000000494 ENSOPRP00000000494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]