SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000562 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000562
Domain Number 1 Region: 653-797
Classification Level Classification E-value
Superfamily C-type lectin-like 4.9e-42
Family C-type lectin domain 0.00000516
Further Details:      
 
Domain Number 2 Region: 144-258
Classification Level Classification E-value
Superfamily C-type lectin-like 5.38e-42
Family Link domain 0.005
Further Details:      
 
Domain Number 3 Region: 260-357
Classification Level Classification E-value
Superfamily C-type lectin-like 1.96e-31
Family Link domain 0.0093
Further Details:      
 
Domain Number 4 Region: 91-148
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000876
Family V set domains (antibody variable domain-like) 0.036
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000000562
Domain Number - Region: 633-662
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0464
Family EGF-type module 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000562   Gene: ENSOPRG00000000608   Transcript: ENSOPRT00000000617
Sequence length 895
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1757:271404:283903:1 gene:ENSOPRG00000000608 transcript:ENSOPRT00000000617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLLLPLLAALALTQVPAALADVLERDSSERPFVIVATHPLQGCLGRATIPCHIHYLRP
LGRGPPGSPRVKGAFLFWGREAEVLVARGLRVKVSEYRFRVALPAYPASLTDVSLVLSEL
RPNDSGIYRCEVQHGIDDSSDAVEVKVKGVVFLYREGSARYAFSFAGAQEACARIGARIA
TPEQLYAAYLGGYEQCDAGWLADQTVRYPIQTPREACYGDMDGFPGVRNYGVVDPDDLYD
VYCYAEDLNGELFLGAPPGKLTWEEARAYCQERGAEIATTGQLYAAWDGGLDRCSPGWLA
DGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFRDSAQPSATPGASN
PASDGLEAIITVTETLEELQLPREAVESESRGAIYSIPILEDGAGGSSTPEDPAEAPRTL
LEFETQSVVPPMESSEEEGKALEKEEKYKDGKEEEEEEEEVVEDEDLWAWPSELSGPGPE
ASLPTEPALEESPSQAMLPARTTPQPLSEGDAETPRPPRIRGPPTETLPTSREGRLASSA
PATPIGAREVGEETGGPELFGVPRGESEEPGSSEEAPSLLPATRPPEGTRELEVPSEENS
GRTDPAGTSVQAQPVLPTDSASRGGVAVAPSSGDCVPSPCHNGGTCLEEEEGARCLCLPG
YGGHLCDVGLRLCSPGWDAFQGACYRHFSTRRSWEEAETQCRMYGAHLTSISTPEEQDFI
NNRYREYQWIGLNDRTLEGDFLWSDGVPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQW
SDVPCNYHLPYTCRMGLVSCGTPPECPLAQLSRPRLRYEVDXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXGRDLQPKKAPEGHQGKLLGRWKARLTSPPRPAPGP
Download sequence
Identical sequences ENSOPRP00000000562 ENSOPRP00000000562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]