SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000588 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000588
Domain Number 1 Region: 217-281
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000157
Family Complement control module/SCR domain 0.00021
Further Details:      
 
Domain Number 2 Region: 38-105
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000792
Family Complement control module/SCR domain 0.00033
Further Details:      
 
Domain Number 3 Region: 98-158
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000747
Family Complement control module/SCR domain 0.00019
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000000588
Domain Number - Region: 193-226
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000725
Family Complement control module/SCR domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000588   Gene: ENSOPRG00000000644   Transcript: ENSOPRT00000000643
Sequence length 356
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4882:26474:42928:1 gene:ENSOPRG00000000644 transcript:ENSOPRT00000000643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWAWPCGSAVLHVLGRLPLLLPLLLLWRVPAAVRGDCGLPPDLPNVMPDLRELSSFLPG
DTVTYTCDTNFVKIPGLSDTATCQESHQWSEMQPFCNRSCEDPPHLIYASLKRPYRDQNY
FPVGSTVEYECRLGYRGPGQPTITCLENLEWSQPEQFCTXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXYQLIGAASSFCLASEHGVNWSNKLPICQEVQCPDPPPIENGRIREES
ASYVYRQGVSYQCNKGFVMVGDGNTFCNEEGAWSTPPPECRXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXTQEAPVSTTTKHTKSTPASEHDSSSGASKIIL
Download sequence
Identical sequences ENSOPRP00000000588 ENSOPRP00000000588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]