SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000600 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000000600
Domain Number - Region: 146-298
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.000617
Family Penicillin V acylase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000600   Gene: ENSOPRG00000000653   Transcript: ENSOPRT00000000658
Sequence length 398
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1153:941312:1008666:-1 gene:ENSOPRG00000000653 transcript:ENSOPRT00000000658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRGRTRLNRVRPFSRSPHPSLRAKSTSARWTEDCRKSTYPPSGPTYRGQVPWYTINLDLP
PYKRWHDLMVDKAATIKIIVNTLKNVVNAFVPSGKIMQIVDEKLPSMLGNFPGPFEEEMK
GIADATGIPLGEIISFNIFYEFFTMCTSIITETKEGHLLHGRNMDFGIFLGWNVNNNTWT
VTENLKPLTVNLDFQKNNKTVFKATSFAGYVGMLTGFKPGRFSLTLNERFSINGGYIGVL
EWILGRKDAMWIGFITRSVLENSTSYEEAKNILTKTKILAPAYFILGGNQSGEGCVITRE
RKDALDVYELAPEQGRWYVVETNYDRWKNPLFLDDRRTPAKMCLNRTTQENISFATLYDV
LSTKPVLNKLTVFTTLMDVTRGHYETYLRDCPDPCIGW
Download sequence
Identical sequences ENSOPRP00000000600 ENSOPRP00000000600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]