SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000615 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000615
Domain Number 1 Region: 27-160
Classification Level Classification E-value
Superfamily C-type lectin-like 5.95e-31
Family C-type lectin domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000615   Gene: ENSOPRG00000000681   Transcript: ENSOPRT00000000674
Sequence length 166
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1212:87856:91246:1 gene:ENSOPRG00000000681 transcript:ENSOPRT00000000674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSARPSLSFLVAIALGFLAAVLASLLLYQWIWGQGSSRALRIGCPGCPDYWMRYGNHCYY
FSEKKKDWNSSMRFCLAEGSHLIVLADNQEMRLLTGFLCEDFHWVGLRKDHGWRWEDGSV
LNSSRIHSNSMVQACGSVNIHGFQASSCEVPLRWICKLSFDNTLLQ
Download sequence
Identical sequences ENSOPRP00000000615 ENSOPRP00000000615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]