SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000628 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000628
Domain Number 1 Region: 90-156
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000445
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 2 Region: 35-98
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000115
Family Complement control module/SCR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000628   Gene: ENSOPRG00000000690   Transcript: ENSOPRT00000000687
Sequence length 204
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4803:42174:53384:-1 gene:ENSOPRG00000000690 transcript:ENSOPRT00000000687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAQISSGPECVEVINNYTSCDEGYYGPQCQFVIQCEPLETPMLGTMACTHPLGNFSFYSQ
CDFNCSEGTKLIGVKETTCGPFGNWSSLEPACQVIQCEPLSAPDFGTMECHHPLAVFGFT
STCTFDCSEGSDLIGNNQTVCGSSGLWDSPSPKCQKVDRSFSMIKEGNYNPLFIPVAVVV
TAFCGLAFIIWLARRLRKGKKSQK
Download sequence
Identical sequences ENSOPRP00000000628 ENSOPRP00000000628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]