SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000636 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000636
Domain Number 1 Region: 22-166
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-34
Family C-type lectin domain 0.00000183
Further Details:      
 
Domain Number 2 Region: 385-451
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000292
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 3 Region: 242-308
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000598
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 180-245
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000106
Family Complement control module/SCR domain 0.0034
Further Details:      
 
Domain Number 5 Region: 443-504
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000334
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000636   Gene: ENSOPRG00000000699   Transcript: ENSOPRT00000000696
Sequence length 566
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4803:80350:86794:-1 gene:ENSOPRG00000000699 transcript:ENSOPRT00000000696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAMHFLSALTFVLLIQESNTWSYYFSGENMTYDEASAYCQQKCAHLVAIQNKEEIDYLN
SILDYSPSYYWIGIRKVNDVWIWVGTQKPLTEEAKNWAPGEPNNKQNNEDCVEIYIKRPK
DTGMWNDERCSKKKLALCYTAACTQASCSGHGECVETINNYTCNCYPGFSGHTCEQVVTC
GAQVKPQHGNLNCIHPLGTFSYNSSCSVACEEGYLPSSTETTWCTSSGQWSAPTATCNVV
KCDAIGKPTNGVVKCSPSQESSPWNTTCAFDCEEGFELQGPQSLQCTSSGSWSDEKPTCT
AVSCGIIHKPQDGSKSCPVCEAFQCIGLFSLKQGYLNCLLYASGSLQSTSSCEFTCEHIV
LTRKSCQWYSIGEDNEKPTREAVKCDPVQTLENGLVDCAHPHTGEFTYQSSCTFKCKEGF
ELHGPTQLKCTSQGQWTQELPSCQAVQCPSLSILGKINTNCSSESVFGTVCNFTCPEGWT
LNGSSVLLCDGTGHWSGMLPTCEAAIEPGVSLAVGLSVGGTSFLTLSSFLLWFLKYFRKK
AKKFVPASSYAGLESQESCPVPSNLI
Download sequence
Identical sequences ENSOPRP00000000636 ENSOPRP00000000636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]