SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Ochotona princeps 76 > ENSOPRP00000000735

Domain assignment for ENSOPRP00000000735 from Ochotona princeps 76

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSOPRP00000000735
Domain Number 1	Region: 71-194
Classification Level	Classification	E-value
Superfamily	Spermadhesin, CUB domain	8.64e-19
Family	Spermadhesin, CUB domain	0.0032
Further Details:

Domain Number 2	Region: 13-50
Classification Level	Classification	E-value
Superfamily	Spermadhesin, CUB domain	0.00000000123
Family	Spermadhesin, CUB domain	0.0048
Further Details:

Domain Number 3	Region: 193-229
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000012
Family	LDL receptor-like module	0.0032
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSOPRP00000000735 Gene: ENSOPRG00000000791 Transcript: ENSOPRT00000000804
Sequence length	416
Comment	pep:known_by_projection genescaffold:pika:GeneScaffold_4027:39145:139675:-1 gene:ENSOPRG00000000791 transcript:ENSOPRT00000000804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	GQNIGIKHSPATQCGIWIRTSNGGHFASPNYPDSYPPNKECIYILEAPPKKEKLLSDEPD FTYLGGILNPIPDCQFELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRF LDYQMEHSNECKRNFVAVYDGSSSIENLKAKFCSTVANDVMLKTGVGVIRMWADEGSRLS RFRMLFTSFIEPPCTGSTFFCHSNMCINNSLVCNGIQNCAYPWDENHCKEKKKAGVFEQI TKTHGTIIGITSGIVLVLLIISILVQVKQPKKVMACTAKTGFQEVFDPPHYELFSLRDKE ISADLADLSEELDNYQKLRRSSTASRCIHDHHCVSQAASVKQSRANLSSMELPCRTDFAQ PQPMKTFNSNIKKSRNTFKQAHEFPEQAIDDQRKGKRIHCKSYIIWDDAAQAPISI
Download sequence
Identical sequences	ENSOPRP00000000735 ENSOPRP00000000735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]