SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000833 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000833
Domain Number 1 Region: 265-396
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.93e-39
Family Nuclear receptor ligand-binding domain 0.000000205
Further Details:      
 
Domain Number 2 Region: 82-156
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-28
Family Nuclear receptor 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000833   Gene: ENSOPRG00000000897   Transcript: ENSOPRT00000000906
Sequence length 618
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_667:213976:225879:1 gene:ENSOPRG00000000897 transcript:ENSOPRT00000000906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYESVEVGGLTPTPNPFLVVDFYNQNRACLLPEKGLPAPGPYSTPLRTPLWNGSNHSIET
QSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYT
CHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPL
TDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRK
RRPSRPHMFPKMLMKITDLRSISAKGAERVITLKXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXRDGVPHWLGNSCLPVPRVHDKQTPRPGSLGAHKPSSPSWPGTVGVGRGWASPVHIY
QPQVLILAGFVFILICLF
Download sequence
Identical sequences ENSOPRP00000000833 ENSOPRP00000000833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]