SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000834 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000834
Domain Number 1 Region: 256-532
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-77
Family Nuclear receptor ligand-binding domain 0.00000000164
Further Details:      
 
Domain Number 2 Region: 204-283
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-29
Family Nuclear receptor 0.0000142
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000000834
Domain Number - Region: 175-217
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 0.012
Family Hydrophobin II, HfbII 0.014
Further Details:      
 
Domain Number - Region: 120-129
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0366
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000834   Gene: ENSOPRG00000000905   Transcript: ENSOPRT00000000907
Sequence length 538
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3847:124351:129436:-1 gene:ENSOPRG00000000905 transcript:ENSOPRT00000000907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWAARPPFLPERHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAAAAAGEQQ
SPEPEPGEAGRDGMGDSGRDSRSPDSSSPNPLTQGIPPPSPPGPPLPASAAPSLGGSGAP
PPPPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGAGPPEDV
KPPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTY
SCRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEM
PVDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPH
FSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDR
SLSRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYC
KQKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
Download sequence
Identical sequences ENSOPRP00000000834 ENSOPRP00000000834 XP_004590316.1.84141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]