SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000871 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000871
Domain Number 1 Region: 10-90
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.41e-24
Family Growth factor receptor domain 0.00000246
Further Details:      
 
Domain Number 2 Region: 155-200
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000157
Family Thyroglobulin type-1 domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000871   Gene: ENSOPRG00000000959   Transcript: ENSOPRT00000000948
Sequence length 200
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_667:280649:295215:1 gene:ENSOPRG00000000959 transcript:ENSOPRT00000000948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPRPSLGDEAIHCPPCTEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVYTPRC
GSGLRCYPPRGTEKPLHTLMHGQGVCMELAEIEAIQASLQPTXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPQGSCQSELHRALERLAASQSRTHE
DLFIIPIPNCDRNGNFHPKQ
Download sequence
Identical sequences ENSOPRP00000000871 ENSOPRP00000000871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]