SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001098 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001098
Domain Number 1 Region: 400-424
Classification Level Classification E-value
Superfamily Notch domain 0.0000667
Family Notch domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000001098
Domain Number - Region: 924-997
Classification Level Classification E-value
Superfamily EF-hand 0.000898
Family Parvalbumin 0.076
Further Details:      
 
Domain Number - Region: 463-490
Classification Level Classification E-value
Superfamily Notch domain 0.00471
Family Notch domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001098   Gene: ENSOPRG00000001173   Transcript: ENSOPRT00000001190
Sequence length 1206
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5354:207140:256036:-1 gene:ENSOPRG00000001173 transcript:ENSOPRT00000001190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVLEWSRDQYHVLFDSYRDNIAGKSFQNRLCLMIDVVTWVNTDELLNELQQVREQEEEQK
AMREILGRNTTEPTKKSEKQLECLLTHCIRVPMLVLDPALPANSTLKDLPSLHPSFHSAS
DVFNVAKPKNPSTNVSVIVFDSAKDVEDAYTGLLKRNSRQAVWRGHLTTDKEVPGLVLMQ
DLAFLSGFPPTFKETSQLRTKLPENLSSKIKLLQLYSEASVALLKLNSPKDFQELNKQTK
KNMTIDGKELTISPAYLLWDLSAISQSKQDEDVSASRFEDNXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKFIYL
NDDVMFGKDVWPDDFYSHSKGQKVYLTWPVPNCAEGCPGSWIKDGYCDKACNNSACDWDG
GDCSGNSAGHRYAAGGGGTGSLGVGQPWQFGGGLNSVSYCNQGCANSWLADKFCDQACNV
LSCGFDAGDCGQEHFHELYKVTLLPNQTHYVLPKGECLPYFSFAEIAKRGVEGAYSDNPI
IRHASIANKWKTIHLIMHKGMNATTIHFNLTFQNSRDEEFKTQITVEVDTREGPKANTTT
QKSYENPVSPVTPLTEMEVLFEDIPEEKRFPKVRRSDGNTTGRAQEQVEIPLVNTSLLPK
EIQLKLHHLDLQLEQGDITVKGYNLSKAALLTSFLMSSQDANVKVSPAVRTDVTNDSMEA
PPLEKQGYESISPSSPGASRGQWSAFPAGTVKANGHYKTQNPPLVLGAKRIFRSEAQTHR
IAGASKEKLSSLVVPLENHEAEGKITGGEEEANRMNPIPTDHNEVIPGRRLQHYTESYRG
FLPWEKKKFFQDLLDEEESLKTQLAYFTDSRRTGRQLQDTFADSLRYVNKILNSKFGFTS
RKVPAHMPHMIDRLVMQELQDMFPEEFDKTSFHKVRHSEDMQFAFSYFYYLMSAVQPLNI
SQVFDEIDTDHSGVLSDREIRTLATRIHDLPLSLQDLTSLEHMLINCSKMLPANITQLSN
IAPTQEAYYDPNLPPVTKSLVTSCKPVTDKIHKAYNDKNKYRFEIMGEEEIAFKMIRTNV
SHVVGQLDDIRKNPRKFVCLNDNIDHNHKDAQTVKAVLRDFYESMFPIPSQFELPREYRN
RFLHMHELQEWRAYRDRLKFWTHCVLATLIIFTVFSFFAEQLIALKRKIFPRRRTHKETS
PDRIRV
Download sequence
Identical sequences ENSOPRP00000001098 ENSOPRP00000001098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]