SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001200 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001200
Domain Number 1 Region: 1580-1821
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.39e-54
Family Ankyrin repeat 0.000000915
Further Details:      
 
Domain Number 2 Region: 930-1052
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.0087
Further Details:      
 
Domain Number 3 Region: 553-595
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000229
Family EGF-type module 0.0033
Further Details:      
 
Domain Number 4 Region: 477-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000122
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 5 Region: 279-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000147
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 6 Region: 354-482
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000282
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 160-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000011
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 588-628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000121
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 196-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000375
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 679-804
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000345
Family Growth factor receptor domain 0.0045
Further Details:      
 
Domain Number 11 Region: 238-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000119
Family EGF-type module 0.022
Further Details:      
 
Domain Number 12 Region: 811-935
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000188
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 13 Region: 1254-1285
Classification Level Classification E-value
Superfamily Notch domain 0.00000034
Family Notch domain 0.0022
Further Details:      
 
Domain Number 14 Region: 316-362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000179
Family EGF-type module 0.014
Further Details:      
 
Domain Number 15 Region: 1043-1087
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000237
Family EGF-type module 0.017
Further Details:      
 
Domain Number 16 Region: 1217-1247
Classification Level Classification E-value
Superfamily Notch domain 0.0000112
Family Notch domain 0.0065
Further Details:      
 
Domain Number 17 Region: 515-557
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000409
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000001200
Domain Number - Region: 1135-1173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000518
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 1176-1205
Classification Level Classification E-value
Superfamily Notch domain 0.00589
Family Notch domain 0.0035
Further Details:      
 
Domain Number - Region: 1089-1127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0161
Family Follistatin (FS) module N-terminal domain, FS-N 0.083
Further Details:      
 
Domain Number - Region: 629-659
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0944
Family EGF-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001200   Gene: ENSOPRG00000001275   Transcript: ENSOPRT00000001302
Sequence length 1996
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5127:30838:51859:-1 gene:ENSOPRG00000001275 transcript:ENSOPRT00000001302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPPLLLLLLPLLLLLLGFPTVMTRGLLCGSFPDPCANGGTCLSLSQEKATCXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQCQLRDFCSANPCVNGGVCLATYPQI
QCRCPPGFEGHACEHDVNECFRDPSPCPKGASCHNTLGSFQCLCPAGRGGPRCEFWAGPC
PHRGCLNGGTCQLLPGADSTFHLCLCPPGFTGTECEVNPDDCVGHPCQNGGTCQDGVGTY
TCLCPETWTGWDCSTDVDECETQAPIRCRNGGTCQNSAGGFHCVCVSGWGSANCEENLDD
CAAATCAPGSTCVDRVGSFSCLCPPGRTGLLCHLEDRCLSQPCHSEAQCSTNPLTGSTLC
LCQPGYSGPTCHQDLDECQMAQQGPSPCEHGGSCLNTPGSFHCLCPPGYTGSRCEANHNE
CLSQPCQPGSTCLDLLATFHCLCPPGLEGRLCEVEIDECASAPCLNHADCHDLLNGXXXX
XXXXFTGTRCEEDMDECRSSPCANGGQCQDQPGAFHCKCLPGFEGPRCETEVDECLSGPC
PPGASCVDLPGAFFCLCPTGFTGQLCEAPLCAPNLCQPEKSCRDQEDKAHCTCPDGSPGC
APADNCTCRHGRCERSSCVCDVGWTGPECEVELAGCVSAPCAHGGTCHPQSSGYNCTCPA
GYTGPTCSEEVTACHSEPCLNGGACSPSPGGYSCTCPPSHTGPQCQTNTDHCVSAPCLNG
GTCVSMPDTSFCICALGFQGPHCEGRTRPSCADSPCSNRATCQDSPQGPRCLCPPGYTGG
SCQTLVDLCAQKPCPLNSHCLQAGPSFHCLCLQGWTGPLCNLPLTPCQKAALSQGIEISS
LCQNGGLCVDSGPSYFCRCPPGFQGSLCQDKGNPCDSRPCQHGATCVAQPNGYLCQCAPG
YSGQNCSKEPDACQSQPCHNHGTCTPTPGGFHCACPPGFVGLRCEGDVDECLDRPCHPTG
TSACHSLANAFYCQCLPGYTGRWCEVETDPCQSLPCSHGGSCEATAGQPPGFTCHCPKGF
EGPTCSHRATPCGPHHCHHGGLCLPSPKPGLPPFCACLNGYGDPDCLTLLSPQGCGPPSP
CLHNGSCSETPWLGGPGFRCSCPPDSPGPRCQRPGTQGCEGRGGDGACDAGCSGPGGNWD
GGDCSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPTCTPAYDQFC
QDHFHNGHCERGCNTAECGWDGGDCRPEGGDATRGPSLALLVVLSPPTLDQQLLALARAL
SLILRVGLWVRKDGDGKDMVFPYPGARAEEELGRTQDPSHQERAAPHTQPLGKETDSLSA
GFVVVMGADLSHCGPEHPASRCPWDSGLLLRLLAAMVAVGALEPLLPGPLLAAHPHAGTA
PPTTQLPWPVLCASVAGVLLLVLGALLVLQLVRRRRREHGALWLPPGFTRQPRTQAAARR
RRPPLGEDSIRLKTLKSEAEVDEDGVVMCSGPEEGEEVSQAEAAASPSTCQLWHLSGGCG
GLPQAAMLTPPQESEKEAPDTDICGPDGVTPMMSAVSCGGVESRTFQGEWLGGPEPWEPL
LDRGACPQAHTVGTGETPLHLAARFSRLTAARRLLEAGANPNQPDRAGRTPLHAAVAADA
REVCQLLLRSRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAARADVGARDKRGKTALH
WAAAVNNARAARCLLQAGADKDAQDNREQTPLFLAAREGAVEVAQLLLLLGASRGLRDHA
GLAPADIARQRNHWDLLTLLEGAEPLDARHKATPGREAGALPRARTASGSVPPRGGGAAP
RSRTLSAGAGPRGGGACPLARPGSVNWAVRRGGAHARCRSQSGGAAGGPPPRGRGLSAGM
RVPRPVPEAALGRCGVAAGCRVTASPQDWPSFYMPLGAGGPASCTPTPPLCLTPSPEQRS
PQVVLVPLDTGGENPK
Download sequence
Identical sequences ENSOPRP00000001200 ENSOPRP00000001200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]