SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001285 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001285
Domain Number 1 Region: 709-813
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 8.63e-27
Family Lipoxigenase N-terminal domain 0.016
Further Details:      
 
Domain Number 2 Region: 23-75
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000227
Family C-type lectin domain 0.033
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000001285
Domain Number - Region: 1323-1387,1425-1501
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00698
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number - Region: 462-607
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0273
Family Aldose 1-epimerase (mutarotase) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001285   Gene: ENSOPRG00000001358   Transcript: ENSOPRT00000001393
Sequence length 1593
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5036:476277:544727:-1 gene:ENSOPRG00000001358 transcript:ENSOPRT00000001393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPTPRSWLWFCIRTALVLGNQWKRECYQLYRSQATLEGAQNYCRNHDGYLPNDWNQNIP
DFIQDSLEEGTKWWIRQKSMPMSEPQEKRPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLTRPSPGGH
CPPLQLKILCQPISPSPVMEITPQVTAGTSPHPELTSSGAIAGTGQSTARRPPRPKTPSK
EGCATFTSTLDQITNNTARNVSRAAQGVPAPRELQEACQVLQGLRTLGSRVFQPAQARII
HALIDLHKQLLADPDPFQNSSLDVSMPVTSCPFQQEMREAGEGSWQGHGQLVEDVLELSL
MALGKLQQAFVQRNQVSGSSVTVTSSSAVVMLSSQNASTLPLSSFAVGGPAPVRLGFPSA
TALEELLKRHPGVSVQVTGLAFNPFEDLDDKNIVGSVGTVLLSSDHKLLHVHGLMEDIEI
MLWRNSSLDTHPTSLNLSTSRFVIALNVTSADKTLLVSLQPEAPLSVTLHLGFQQPPEPT
SSPHNITLPRDQVWQKDEEYTWVLTPESLQYGTGTYYITAVLEGDTQTPVSVVTAVTQCY
FWNSHERAWKSNGCQVGARSTVRRTQCLCNHLTFFGSDFFILPRTVNVEDTVQLFLRVSS
NPVGVSLLASLLAFYATLALWAWRKDQADAQKVKVTMLADSDPGGRFHYLIQVYTGYRRR
AATTAKVVLTLYGSEGRSEPHHLADPHKPVFERGALDVFLLATRSPLGQLHSLRLWHDNS
GASPAWYVTRVVVSDLTLQRKWHFLCHCWLAVDLGDCERDRIFLPASHGELLSFRHLFPS
VMVEKFTQDYLWLSVATRHPWSPFTRVQRLSCCVTLLLCNMLINVMFWKANAAVAGQEAP
MGPLAVTWSELRISLQTAVILFPINLVVGRLFLLTQPQEALPPIPQAWACLSDAXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXAPENQRLLSCYLLGVVERLQSRLGALSPSQVPSPGDVQEAASQLRRLRDLLRT
QTVPVEQDVSREVTCFPLLSPEAERNSSIAGWCQRLSYASWTLLSAAGLAAAFFTALYSL
DLNRDQASSWVVSMMLSLLQNICISQPVKVVILTFGLSLLMKRVPWLNRESEQRRILALA
AKCSSSPPASRDRNNPVYVAPTMHGPARCPAGAVGRRRLCRIAAGIMVQTLFLVLLMTRT
YSAQNSNRFYLHQAIRKSLAPGFAKIRLLEEFYPWARHSLLPHLFGDGRGEALFSSVSVD
SLPALQASQMGIGWDVISQVLYHLLVCYYTFVQGWRLKRQGWRFLTQKRNVLDTSVVLIS
FVILALDMTRISLHQKHMAQHRQDPDGFVSFSEALSVNCATTYLVGILVLLATLQLWHLL
HHDARLQVISRTLSKAWDEVTGFLLIILVLLTGYAIAFNLLFGWSISNYRTFINSAVTVV
GLLVGVSHHKEVIALDPVLGGFLTLTSVVLMVLVIINLFVSAILMAFGRERKSLKRETTL
IDVLLHKLSGLLGIRRHAAPPPAAAGVPEGKPP
Download sequence
Identical sequences ENSOPRP00000001285 ENSOPRP00000001285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]