SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001288 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001288
Domain Number 1 Region: 38-173
Classification Level Classification E-value
Superfamily C-type lectin-like 6.82e-36
Family C-type lectin domain 0.00000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001288   Gene: ENSOPRG00000001412   Transcript: ENSOPRT00000001396
Sequence length 175
Comment pep:novel genescaffold:pika:GeneScaffold_773:140731:142841:-1 gene:ENSOPRG00000001412 transcript:ENSOPRT00000001396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFPMGLTRVSWMLVSCLMLLSQVQGEDSQKDVASPKISCPSGSKVYGCYCYAVFVTPKS
WTDAELACEKRSSGHLVSVLTAGEASFVSSLVRSTANSYSYIWIGLHDPTQGTEDNAEGW
EWVSLDVTNYSAWERNPSTAANRGYCGSLSLSSTFLKWRDYNCDSHLPYICKFKG
Download sequence
Identical sequences ENSOPRP00000001288 ENSOPRP00000001288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]