SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001328 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000001328
Domain Number - Region: 208-246
Classification Level Classification E-value
Superfamily HMG-box 0.006
Family HMG-box 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001328   Gene: ENSOPRG00000001449   Transcript: ENSOPRT00000001442
Sequence length 246
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1798:98895:103000:1 gene:ENSOPRG00000001449 transcript:ENSOPRT00000001442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPVKVKVEKSELEMAKARNQLDAVLQGLLEKSHMDRERLDEEAGKTPSDTQSKDCSIAA
TGKRPSARFPHQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR
AWMRNSPSVRERDRSPSSPLPPLPEDEEGSEAANSKSRDVYKLPPPMAPGPPGDACSSRV
PSPLQPETQGSPDHETSEPEPSHSTLIYRNMQRWKRIRQRWKEASHRNQLRYSESMKILR
EMYERQ
Download sequence
Identical sequences ENSOPRP00000001328 ENSOPRP00000001328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]