SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001410 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001410
Domain Number 1 Region: 318-356,394-621
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.4e-28
Family N-type ATP pyrophosphatases 0.02
Further Details:      
 
Domain Number 2 Region: 1-186
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.000000000000424
Family Class II glutamine amidotransferases 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001410   Gene: ENSOPRG00000001542   Transcript: ENSOPRT00000001529
Sequence length 642
Comment pep:known_by_projection scaffold:pika:scaffold_38684:3699:8295:1 gene:ENSOPRG00000001542 transcript:ENSOPRT00000001529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGICCSVSFSVDHFSKDLEEDLLCNLKRRGPDSSKQLLRCDANYWCLFSGHVLHLRGVL
TAQPVEDERGNVFLWNGEVFDGIKVEALENDTQILFSYLSSCKSESDIVSLFSKVQGPWS
FIYYQASSHDLWFGKDFFGRRSLLWRFNNLGKSFCLSSVGPQTTGVASQWQEVPASGIFR
INLESVAISKHVMLQLYPWKCISRDGVTEECDSSLPQVSADLPTFVSVVGNEAKLYLENP
IAPLNMMLPQTPVETLCSPTPSSPPSKETLQVCLTDGHMKEVVEQFIDVLSVAVKRRVLC
LCRDKSPAPAGVLKPDEKKAKIAILFSGGIDSMVIAALADRHIPLDEPIDLLNVAFMTKG
KTAPSSCKQTRSKRTQRELPPEEFTERAAVTADDSPPEKYCVPDRITGRAGLKELRALNP
SRVWNFVEINVSLEELQKFRRAQIRHLVHPLDTVLDDSIGCAVWFASRGTGWLATRDSVK
SYESSAKVILTGIGADEQLAGYSRHRVRFQTHGLEGLNKEIAMELGRISSRNLGRDDRVI
GDHGKEARFPFLDEDVVSFLNSLPVWEKANLTLPRGIGEKLILRLAAVELGLTASALLPK
RAMQFGSRIAKMENNNEKASDKCGRLQVVSLEKHFCEKEVQS
Download sequence
Identical sequences ENSOPRP00000001410 ENSOPRP00000001410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]