SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001418 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001418
Domain Number 1 Region: 198-509
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.04e-73
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000351
Further Details:      
 
Domain Number 2 Region: 1087-1286
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.62e-53
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000621
Further Details:      
 
Domain Number 3 Region: 504-707
Classification Level Classification E-value
Superfamily Ribosomal protein L25-like 5.75e-53
Family Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain 0.00044
Further Details:      
 
Domain Number 4 Region: 1289-1418
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.26e-29
Family Anticodon-binding domain of Class II aaRS 0.00015
Further Details:      
 
Domain Number 5 Region: 1422-1509
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 9.81e-18
Family C-terminal domain of ProRS 0.005
Further Details:      
 
Domain Number 6 Region: 50-162
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.69e-17
Family Glutathione S-transferase (GST), C-terminal domain 0.046
Further Details:      
 
Domain Number 7 Region: 751-799
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.00000000169
Family a tRNA synthase domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001418   Gene: ENSOPRG00000001503   Transcript: ENSOPRT00000001537
Sequence length 1509
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4901:74978:145903:-1 gene:ENSOPRG00000001503 transcript:ENSOPRT00000001537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALCLTVNSGDPPLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNVVFTDINSILRYMAR
VANRVGLYGSNLLEHTEIDHWLEFSATKLSSCDMFPSAVNELNHCLSLRTYLVGNSLSLA
DLCVWATLKGSVAWQAQLKENKTPVHVKRWFSFLHAKQAFQSVGSKWGVSVNKANKVAPE
KKQDIGKFVELPGAEMGKVTVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDT
NPEKEKEDFEKVILEDVAMLHIKPDQFTYTSDHFETIMKYAEKLIQEGKAYVDDTPAEQM
KAEREQRLESKHRRNSIEKNLQMWEEMKKGSQFDQTCCLRAKLDMSSNXXXXXXXXXXXX
XXXXXXXXXXXXXVYPTYDLACPIVDSIEGVTHALRTTEYHDRDEQFYWIIEALGIRKPY
IWYSRLNLNNTVLSKRKLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGS
SRSVVNMEWDKIWAFNKKVIDPVAPRYVALLKKEVVPVNVPEAQEEMKEVAKHPKNPDVG
LKPVWYSPKIFIEGADAETLSEGEMVTFINWGNINITKIHKNADGKILSLDAKLNLENKD
YKKTTKITWLAETAHALPIPAICVTYEHLITKPVLGKDEDFKQYVNKDSKREELMLGDPC
LKDLRKGDIIQLQRRGFFICDQPYEPVSPYSCKEAPCILIYIPDGHTKEMPTFGSKEKTK
GEAIKTEKTPVKEKPAPALTSACAASEDPVLLYSRVAAQGDVVRELKTKKAKEDIDTAVK
KLLLKAEYKEEVGQEYKPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIR
LNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATFEEAAEEVLQILNLYVRVYEELLAI
PVVKGRKTEKEKFAGGDYTTTIEAFISSSGRAIQGATSHHLGQNFSKMCEIVFEDPKTPG
EKQFAYQCSWGLTTRTIGVMVMVHGDNMGLVLPPRVASVQVVVIPCGITNALSEEDREAL
VAKCNDYRRRLLSVSIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKNCQFVAVR
RDTGEKLTIAENEAETKLQTILEDIQANLFARASEDLRTHMVVADTMEEFQKILDSGKIA
QIPFCGEIECEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLRELQPGAKCICGKNPAK
FYTLFGRSY
Download sequence
Identical sequences ENSOPRP00000001418 ENSOPRP00000001418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]