SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001548 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000001548
Domain Number - Region: 169-297,356-385
Classification Level Classification E-value
Superfamily YWTD domain 0.000994
Family YWTD domain 0.025
Further Details:      
 
Domain Number - Region: 503-547
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0353
Family Hormone receptor domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001548   Gene: ENSOPRG00000001648   Transcript: ENSOPRT00000001678
Sequence length 1426
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2936:18490:555542:1 gene:ENSOPRG00000001648 transcript:ENSOPRT00000001678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSILTVSLLLQRPAFSRAPIPMAVVRRELSCESYPIELRCPGTDVIMIESANYGRTDDKI
CDSDPAQMENIRCYLPDAYKIMSQRCNNRTQCAVVAGPDVFPDPCPGTYKYLEVQYECVP
YRIDWKVFLCPGLLKGVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPWTPYRTDTLTEY
SSKDDFIAGRPTTTYKLPHRVDGTGFVVYDGALFFNKERTRNIVKFDLRTRIKSGEAIIA
NANYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQNNGKIVISQLNPYTLRIEGTWDTAY
DKRSASNAFMICGILYVVKSVYEDDDNEATGNKIDYIYNTEQSKDSLVDVPFPNSYQYIA
AVDYNPRDNLLYVWNNYHVVKYSLDFGPLDSRSXXXXXXXXXXXXXXXXXXXXXXXXXXX
XISTTGPLGMGSTTTSTTLRTTTWSPGRSTTPSMSGRRNRSTSTPSPAVELLDDITTHLP
SASSQVPAPEESCEAVEAREIMWFKTRQGQTAKQPCPAGTIGVSTYLCLAPDGIWDPQGP
DLSNCSSPWVNHITQKLKSAETAANIARELAEQTRNHLNAGDITYAVRAMDQLVGLLDVQ
LRNLTPGGKDSAARSLNKAMVETVNNLLQPQALNAWRDLTTSDQLRAATMLLDTVEESAF
VLADNLLKTDIVRENTDNIQLEVARLSTEGNLEDLKFPESTGHGSSIQLSANTLKQNGRN
GEIRVAFVLYNNLGPYLSTENASVKLGTEAMSTNHSVIVNSPVITAAINKEFSNKVYLAD
PVVFTVKHIKQSEENFNPNCSFWSYSKRTMTGYWSTQGCRLLTTNKTHTTCSCNHLTNFA
VLMAHVEVKHSDAVHDLLLDVITWVGILLSLVCLLICIFTFCFFRGLQSDRNTIHKNLCI
SLFVAELLFLIGINRTDQPXXXXXXXXXXXFSFLAASTGVFGKAVHSSIMLVEFGADLSR
PEYLLVGYGLPGLIVAVSAAVDYRSYGTDKVXXXXXXXXXXXXXXXXXXXXXXLNVIFLG
IALYKMFHHTAILKPESGCLDNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXSRIRRMWNDTVRKQSESSFIGDINSSASLNRXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXLPLLTSEHTEELPASPRDSVYTSMPALAEAVAAGPAEHPPGRRGADDVYYKS
MPNLGSRHVHQLHTYYQLGRGSSDGFIVPPNRGPAPGTGPSHLVSL
Download sequence
Identical sequences ENSOPRP00000001548 ENSOPRP00000001548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]