SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001597 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001597
Domain Number 1 Region: 181-269
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.000000000323
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00048
Further Details:      
 
Domain Number 2 Region: 449-490
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.0000128
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000001597
Domain Number - Region: 126-179
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.000272
Family Seryl-tRNA synthetase (SerRS) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001597   Gene: ENSOPRG00000001727   Transcript: ENSOPRT00000001731
Sequence length 518
Comment pep:novel genescaffold:pika:GeneScaffold_937:832:9166:-1 gene:ENSOPRG00000001727 transcript:ENSOPRT00000001731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASIARRLACLLSPGGLRLRAGCAGSQSPRRTFASERRDRNLLYEHAREGYSALPQLDM
ESVCACPEAVARALELRKGALRPADLQGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XVNRDSQQVQQEPQYQALRARGREIRKQLVLLYPRETQLEEQFYLHALRLPNQTHPDTPI
GDESQARVLHVIGDKPAFSFPPRGHLELGEKLGIIRQKRLSHVSGHRSYYLRGAGALLQH
GLVSFTLSKLVRRGFIPMAVPDLLRGAVFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXMNATACAVPRLLIGLLESSQQKDGSVRVPPA
LQPYLGVNCITTPTHTPLQYIGPNQPQKPRLPSRPARS
Download sequence
Identical sequences ENSOPRP00000001597 ENSOPRP00000001597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]