SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001668 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001668
Domain Number 1 Region: 1-329
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.57e-81
Family Phosphofructokinase 0.00000285
Further Details:      
 
Domain Number 2 Region: 374-671
Classification Level Classification E-value
Superfamily Phosphofructokinase 2.88e-70
Family Phosphofructokinase 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001668   Gene: ENSOPRG00000001792   Transcript: ENSOPRT00000001808
Sequence length 677
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2571:2802:16042:1 gene:ENSOPRG00000001792 transcript:ENSOPRT00000001808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYEGLVEGGENIQQASWLSVSNIIQLGGTIIGSARCKAFTTREGRRAAAYNLVQRGITNL
CVIGGDGSLTGANIFRSEWGSLLEELVQEGKISESTAQTYSHLNIAGLVGSIDNDFCGTD
MTIGTDSALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEA
PPEDGWENFMCERLGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXYVKDLVVQRLGFDTRV
TVLGHVQRGGTPSAFDRVLSSKMGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQ
VTKEVQKAMDERRFDEAIQLRGRSFENNWNMYKLLAHQKLSKEKXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXQGHTVYVVHDGFEGLVKGQVQEVSWHDVAGWLGRGGSMLGTKXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXAYEGVLQLVEARGRYEELCIVMCVVPATISNNVP
GTDFSLGSDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAY
VFEDPFNIHDLKANVEHMTEKMKTDIQRGLVLRNEKCHDYYTTEFLYNLYSSEGGVFDCR
TNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWVSEMLRAVYRKGRVFANAPDSACVIGLRK
KAVAFSPVTELKKDTDF
Download sequence
Identical sequences ENSOPRP00000001668 ENSOPRP00000001668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]