SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001715 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001715
Domain Number 1 Region: 27-72
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000213
Family EGF-type module 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001715   Gene: ENSOPRG00000001868   Transcript: ENSOPRT00000001861
Sequence length 148
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3470:91705:154674:-1 gene:ENSOPRG00000001868 transcript:ENSOPRT00000001861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVLAVCQALENSTSPLSDPPVAAAVVSHFNDCPDTHTQFCFHGTCRFLVQEDKPACVCHS
GYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRA
LVCRHEKPSALLKGRTACCHSETGCLYS
Download sequence
Identical sequences ENSOPRP00000001715 ENSOPRP00000001715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]