SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001739 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001739
Domain Number 1 Region: 3-99
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 6.31e-26
Family Proteasome subunits 0.00000238
Further Details:      
 
Domain Number 2 Region: 158-204
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.00000896
Family Proteasome subunits 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001739   Gene: ENSOPRG00000001900   Transcript: ENSOPRT00000001885
Sequence length 204
Comment pep:novel genescaffold:pika:GeneScaffold_228:54821:61707:1 gene:ENSOPRG00000001900 transcript:ENSOPRT00000001885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQ
TVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPEHLFETISQAMLNAVDRDAVS
GMGVIVHIIEKDKITTRTLKARMD
Download sequence
Identical sequences ENSOPRP00000001739 ENSOPRP00000001739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]