SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001747 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001747
Domain Number 1 Region: 220-362
Classification Level Classification E-value
Superfamily S-adenosylmethionine synthetase 2.86e-66
Family S-adenosylmethionine synthetase 0.0000000637
Further Details:      
 
Domain Number 2 Region: 96-219
Classification Level Classification E-value
Superfamily S-adenosylmethionine synthetase 6.48e-50
Family S-adenosylmethionine synthetase 0.00000027
Further Details:      
 
Domain Number 3 Region: 1-93
Classification Level Classification E-value
Superfamily S-adenosylmethionine synthetase 1.77e-38
Family S-adenosylmethionine synthetase 0.00000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001747   Gene: ENSOPRG00000001898   Transcript: ENSOPRT00000001892
Sequence length 363
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3873:66780:69761:1 gene:ENSOPRG00000001898 transcript:ENSOPRT00000001892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KICDQISDAVLDAHLQQDPDAKVACETVAKTGMILLAGEITSRAAVDYQKVVREAIKHIG
YDDSSKGFDYKTCNVLVALEQQSPDIAQGVHLDRNEEDIGAGDQGLMFGYATDETEECMP
LTIVLAHKLNAKLAELRRNGTLPWLRPDSKTQVTVQYMQDRGAVLPIRVHTIVISVQHDE
EVCLDEMRDAKEKVIKAVVPAKYLDEDTIYHLQPSGRFVIGGPQGDAGLTGRKIIVDTYG
GWGAHGGGAFSGKDYTKVDRSAAYAARWVAKSLVKGGLCRRVLVQVSYAIGVSHPLSISI
FHYGTSQKSERELLEIVKKNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKK
LKY
Download sequence
Identical sequences ENSOPRP00000001747 ENSOPRP00000001747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]