SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002088 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002088
Domain Number 1 Region: 17-109
Classification Level Classification E-value
Superfamily Kringle-like 7.25e-19
Family Kringle modules 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002088   Gene: ENSOPRG00000002262   Transcript: ENSOPRT00000002260
Sequence length 261
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4625:456628:466006:-1 gene:ENSOPRG00000002262 transcript:ENSOPRT00000002260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMQLPWVQFVLSNMLLAEAYSGGCFWDHGHLYREDQPSPAPGLRCLNWLDVQSNRLAPGP
ESGADNHNYCRNPDQDPRGPWCYVSGQTGAPEKRSCEDLRCPETTSQDPGASSTETEEEA
PGAEPAQVFPPANALPARSEAAAVQPAVGISQRVRMNSKEKKDLGTLGYVLGITMMVIII
AIGAGIILGYTYKRGKDLKAQHEQKACEREMQRITLPLAAFTNPTCELVDEKTVVVHASQ
TPVGPQEGSIPLMGQAGTPGA
Download sequence
Identical sequences ENSOPRP00000002088 ENSOPRP00000002088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]