SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002095 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002095
Domain Number 1 Region: 135-248
Classification Level Classification E-value
Superfamily C-type lectin-like 3.54e-32
Family C-type lectin domain 0.00000437
Further Details:      
 
Domain Number 2 Region: 104-129
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.0000000785
Family Triple coiled coil domain of C-type lectins 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002095   Gene: ENSOPRG00000002279   Transcript: ENSOPRT00000002266
Sequence length 248
Comment pep:novel scaffold:pika:scaffold_11638:21565:23698:-1 gene:ENSOPRG00000002279 transcript:ENSOPRT00000002266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFSLALILISLAVSNIMGDVNDVCVGSPGIPGAPGTHGLPGRDGRDGVKGDPGPPGPM
GPPGGMPGLPGRDGLIGAPGVAGERGDKGEPGERGPPGLPAYMDEELQSTLHELRQQILQ
SMGVLSLQGSMLAVGEKIFSTNGKSVNFDAAQELCAQAGGHIAVPRNAEENEAIASIVKN
RNTYAYLGLVEGPNPGDFHYLDGDPVNYTNWYTGEPRGQGRENCVEMYTDGKWNDKSCLQ
YRLVICEF
Download sequence
Identical sequences ENSOPRP00000002095 ENSOPRP00000002095 XP_004583583.1.84141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]