SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002221 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002221
Domain Number 1 Region: 18-123
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.31e-19
Family Hormone receptor domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002221   Gene: ENSOPRG00000002405   Transcript: ENSOPRT00000002399
Sequence length 366
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_12:815:21895:-1 gene:ENSOPRG00000002405 transcript:ENSOPRT00000002399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPTAVNPASENDTELTLEPEPFLYVIGRKKLLDAQFRCYNRMEQLPPYQGEGPYCNRTWD
GWLCWDDTPAGVLTYQYCPDYFPDFDPTXXXXXXXXXXXXXXXXXXXXQTWSNYTMCNAF
TSEKLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLGCQRVTLHKNMFLTYILNSMI
IIIHLVEVVPNGELVRRNPVSCKVLHFFHQYMMSCNYFWMLCEGIYMHTLIVVAVFAKQR
HLRWYYLLGWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNFFFLL
NIVRVLVTKMRETHEAESHMYLKAVKATMILVPLLGVQFVVFPWRPSNKILGKIYDYLMH
SLIHFQ
Download sequence
Identical sequences ENSOPRP00000002221 ENSOPRP00000002221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]