SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002353 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002353
Domain Number 1 Region: 2-263
Classification Level Classification E-value
Superfamily Bet v1-like 2.2e-87
Family Phoshatidylinositol transfer protein, PITP 0.00000000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002353   Gene: ENSOPRG00000002540   Transcript: ENSOPRT00000002548
Sequence length 268
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3889:510236:564229:-1 gene:ENSOPRG00000002540 transcript:ENSOPRT00000002548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLIKEFRVVLPCSVQEYQVGQYSVAEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGT
LENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKELN
KPDCPQMCAYKLVTIKFKWWGLQSVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIR
RMEDETQKELETLRSQGQVRGTSAASDE
Download sequence
Identical sequences ENSOPRP00000002353 ENSOPRP00000002353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]