SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002387 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002387
Domain Number 1 Region: 609-912
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 9.23e-116
Family PDEase 0.0000000826
Further Details:      
 
Domain Number 2 Region: 200-399
Classification Level Classification E-value
Superfamily GAF domain-like 1.42e-46
Family GAF domain 0.0001
Further Details:      
 
Domain Number 3 Region: 366-561
Classification Level Classification E-value
Superfamily GAF domain-like 5.3e-17
Family GAF domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002387   Gene: ENSOPRG00000002569   Transcript: ENSOPRT00000002585
Sequence length 934
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4900:71560:499589:-1 gene:ENSOPRG00000002569 transcript:ENSOPRT00000002585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTATHLDFGEVETFLDRHPELLEDYLMRKGKQEILEKWLQRHSQCQEVLDSRPAPTGTTG
TAQSSSGKGASGVGGGSGPFGSASSQPTSGSGDCAGVPLSPSWASGSRVDGSLQRRASQK
ELRKSFARSKAIHVNRTYDEQVTSRAQEPLSSVRRRALLRKASSLPPTTAHILSALLESR
VNLPQYPPTAIDYKCHLKKHNERQFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCS
LFLVEGAAAGKKSLVSKFFDVHAGTPLLPCSTTENSNEVQVPWGKGIIGYVGEHGETVNI
PDAYQDRRFNDEIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKIPEGAPFTEDDEKVM
QMYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLK
CERCSVLLLEDIESPVVKFTKSFELLSPKCSADAENSFKESLEKSSYSDWLINNSIAELV
ASTGLPVNISDAYQDPRFDAEXXXXXXXXXXXXXXXXXXXXXXXXXXVAQVLNRLDGKPF
DDADQRLFXAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAAN
IPLVSELAIDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYR
MVLYHNWRHAFNVCQLMFAMLTTAGFQEILSEVEILAVIVGCLCHDLDHRGTNNAFQAKS
GSALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTL
YFERRTEFFELVSKGEYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFF
EQGDRERSELKLTPSAIFDRNRKDELPRLQLEWIDSICVPLYQALVKVNGKLKPMLDSVS
ANRSKWEELHQRGLQVSAAATAPAAHVVATEDGN
Download sequence
Identical sequences ENSOPRP00000002387 ENSOPRP00000002387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]