SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002433 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002433
Domain Number 1 Region: 158-487
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 5.94e-61
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000225
Further Details:      
 
Domain Number 2 Region: 489-621
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.41e-31
Family Ricin B-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002433   Gene: ENSOPRG00000002636   Transcript: ENSOPRT00000002633
Sequence length 622
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2473:44106:68203:-1 gene:ENSOPRG00000002636 transcript:ENSOPRT00000002633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLRRRHMPLRLAVAGSAFLLFLFIMQRDVSSREQATEKPWLNSLVGQKGHMLDLMLGA
MNNLRDSMPKLQIRAPEPQQTQAPANRSCLPGFYSPAELKPFWERPPQDPKSPGADGKAF
HKSEWTPQEKQEKEEGYKKHCFNAFASDRISLQRALGPDTRPPECVDQKFRRCPPLPTTS
VIIVFHNEAWSTLLRTVYSVLHTAPAILLREIILVDDASTEEYLKEELEQYVKQLQVVRV
VRQPERKGLITARLLGASVAQAEVLTFLDAHCECFNGWLEPLLARIAEDETAVVSPDIVT
IDLNTFEFAKPMPRGRVHSRGNFDWSLTFGWEAIPTHERQRRKDETYPIKSPTFAGGLFS
ISKSYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKG
TNVIARNQVRLAEVWMDNYKMIFYRRNQQAAKMAQEKSFGDISERLRLREQLHCRNFSWF
LHNVYPEMFVPDLNPTFYGAIKNLGLGQCLDVGENNRGGKPLIMYPCHGLGGNQYFEYTT
QKDLRHNIAKQLCLHVGTGTLGLRGCHFTGKNSQVPKDEEWELTQDQLIRNSASGTCLTS
RDKKPAMAPCNPTDPHQLWLFV
Download sequence
Identical sequences ENSOPRP00000002433 ENSOPRP00000002433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]