SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002440 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002440
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Lipocalins 3.01e-34
Family Fatty acid binding protein-like 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002440   Gene: ENSOPRG00000002661   Transcript: ENSOPRT00000002642
Sequence length 82
Comment pep:known_by_projection scaffold:pika:scaffold_70103:1065:4866:-1 gene:ENSOPRG00000002661 transcript:ENSOPRT00000002642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDSFVGTWKLVESKNFDDYMKSLGVGFATRQVANMTKPTTIIEKKGDTIVLKTQSTFKN
TEISFKLGVEFDETTADDRKVK
Download sequence
Identical sequences ENSOPRP00000002440 ENSOPRP00000002440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]