SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002486 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002486
Domain Number 1 Region: 230-401
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 7.06e-52
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00013
Further Details:      
 
Domain Number 2 Region: 380-500
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.94e-28
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00018
Further Details:      
 
Domain Number 3 Region: 555-686
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.33e-28
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000284
Further Details:      
 
Domain Number 4 Region: 193-225
Classification Level Classification E-value
Superfamily TGS-like 0.0000314
Family TGS domain 0.0086
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000002486
Domain Number - Region: 757-799
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.000245
Family Anticodon-binding domain of Class II aaRS 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002486   Gene: ENSOPRG00000002689   Transcript: ENSOPRT00000002698
Sequence length 805
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4676:293:118336:-1 gene:ENSOPRG00000002689 transcript:ENSOPRT00000002698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEALEAEARAVEALTLRLERQEEDLRWLWGEVRRIRTAPLSAPERCVTGRPNLSREVA
QLRAENYQLRQQAYRLRLGLAEVQRRQAEQRAALTAGAGVQXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXLELAESAVVAKVNGELWDLERPLLGDCSLELLTFDSEEARXXVYWHSSA
HVLGEAMELYYGGHLCYGPPVEDGFYYDMFIEDRAVSSSDLPALEDMCKDIIKERQPFER
LEVSKDVLLDMFKYNKFKCRILNEKVDTPTTTVYRCGSLIDLCKGPHVRHTGKIKAIKLF
KNSSTYWEGNPAMETLQRIYGISFPDSKMLRTWEQLQEEARSRDHRKIGKEQELFFFHEL
SPGSCFFLPRGAFIYNTLMDFLREEYHKRDFTEVLSPNMYNSRLWETSGHWQYYHENMFT
FEVEKDTFSLKPMNCPGHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXIEGEIKGCLQFLQCVYSTFGFTFQLNLSTRPDSFLGEATLWAEAEKQ
LQNSLMEFGKPWKVNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVSK
DGDDKKRPVIIHRAILGSVERTVAILCENYGGKXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVGEKEKANNAVNIRTRDNKIHGE
TSVSSAIERLKNLQKSRVLNAEEEF
Download sequence
Identical sequences ENSOPRP00000002486 ENSOPRP00000002486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]