SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002541 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002541
Domain Number 1 Region: 4-147
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000034
Family Spermadhesin, CUB domain 0.0099
Further Details:      
 
Domain Number 2 Region: 147-181
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000124
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002541   Gene: ENSOPRG00000002761   Transcript: ENSOPRT00000002757
Sequence length 243
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4788:34796:41696:1 gene:ENSOPRG00000002761 transcript:ENSOPRT00000002757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLVHLCGQTWQGPGMLLRSHPTSRRFYFVAPDTDCKLWIQAADPGDRIHLQFRFFLVYSL
MSASPTHPAPNVSTPEPSDPCVAGSYLQLYEGSPGEAQPLGAPLCGLTIPVPVVSSGHFL
GLRLVTRGRQPRVDFVGEVTSFRLGPCGAYFRCHNGKCIPPSLVCDRWSIDNCGDGSDQA
SWAPANCRVPSPVPSHTGSSAVDSSKSSPLRSAGTLWITSQGSPPEAWGRVPQDTALQGI
LEP
Download sequence
Identical sequences ENSOPRP00000002541 ENSOPRP00000002541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]