SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002546 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002546
Domain Number 1 Region: 68-198
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.87e-28
Family Proteasome subunits 0.0000104
Further Details:      
 
Domain Number 2 Region: 1-25
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.0000181
Family Proteasome subunits 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002546   Gene: ENSOPRG00000002774   Transcript: ENSOPRT00000002765
Sequence length 199
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5120:1723:4598:1 gene:ENSOPRG00000002774 transcript:ENSOPRT00000002765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTIMAVEFDGGVVVGSDSRVSAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXLELEEPPLVLAAANVVKNITYKYREDLSAHLMIAGWDQREGGQVYGTLEGMLI
RQPFAIGGSGSTYIYGYVDAAYKPGMSPEECRRFTTDAITLAMNRDGSSGGVIYLVTITA
AGVDHRVILGNELPKFYDE
Download sequence
Identical sequences ENSOPRP00000002546 ENSOPRP00000002546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]