SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002590 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002590
Domain Number 1 Region: 300-343
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000894
Family C-type lectin domain 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000002590
Domain Number - Region: 207-290
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0228
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002590   Gene: ENSOPRG00000002822   Transcript: ENSOPRT00000002814
Sequence length 343
Comment pep:known_by_projection scaffold:pika:scaffold_2289:198309:205896:-1 gene:ENSOPRG00000002822 transcript:ENSOPRT00000002814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDTVHFCTEEQCVFLQPQGADSTPEAPAALRRLRFVQATIALLAMITVSYLVAVFVMA
LQSQGPAPRPVQAMLLGVNATGQSPVELNNYSHTDNIEEVQAVIQMFKSHVENSSPWGRE
IQMLMCRVDNISSQLQVLSGHLENTSSDMQSVQDALQTASTWSSQTQTLLQGSLDSVTAE
LQVLRGRIGGAGSEILLLKEDLEIIPQTDAQLQLLKAKLEDVNSYTSQIQAFGDQLNKAG
REIETLRQGMADAEALNSQTRALESDLKQAISEQQRRLETALASQEQLHKTQARVLRASL
EGWKFYRGNLYYFSEDKKSWHQAEQFCVSQGTHLASVTSVEEQ
Download sequence
Identical sequences ENSOPRP00000002590 ENSOPRP00000002590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]